SCOPe 2.08: Domain d2tmda3: 2tmd A:341-489,A:646-729

Lineage for d2tmda3 (2tmd A:341-489,A:646-729)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families)
   this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains

5. Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 proteins)

6. Protein Trimethylamine dehydrogenase, middle domain [51973] (1 species)

7. Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51974] (5 PDB entries)

8. Domain d2tmda3: 2tmd A:341-489,A:646-729 [30602]
   Other proteins in same PDB: d2tmda1, d2tmda2, d2tmdb1, d2tmdb2
   complexed with adp, fmn, sf4

Details for d2tmda3

PDB Entry: 2tmd, 2.4 Å

PDB Description: correlation of x-ray deduced and experimental amino acid sequences of trimethylamine dehydrogenase

PDB Compounds: (A:) trimethylamine dehydrogenase

SCOPe Domain Sequences for d2tmda3:

Sequence; same for both SEQRES and ATOM records:

>d2tmda3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
dirvcigcnvcisrweiggppmictqnatageeyrrgwhpekfrqtknkdsvlivgagps
gseaarvlmesgytvhltdtaekigghlnqvaalpglgewsyhrdyretqitkllkknke
sqlalgqkpmtaddvlqygadkviiatgaXsectlwnelkaresewaendikgiyligda
eaprliadatftghrvareieeanpqiaipykretiawgtphmpggnfkieykv

Timeline for d2tmda3:

• d2tmda3 first appeared (with stable ids) in SCOP 1.55
  
• d2tmda3 appears in SCOPe 2.07