SCOPe 2.06: Domain d3n3vd_: 3n3v D:

Lineage for d3n3vd_ (3n3v D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein CDC42 [52619] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52620] (30 PDB entries)

8. Domain d3n3vd_: 3n3v D: [306015]
   automated match to d2dfkd_
   complexed with amp, gdp, mg, so4

Details for d3n3vd_

PDB Entry: 3n3v, 2.3 Å

PDB Description: Crystal Structure of IbpAFic2-H3717A in complex with adenylylated Cdc42

PDB Compounds: (D:) Cell division control protein 42 homolog

SCOPe Domain Sequences for d3n3vd_:

Sequence; same for both SEQRES and ATOM records:

>d3n3vd_ c.37.1.8 (D:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
tikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtagqe
dydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlrdd
pstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalep

Timeline for d3n3vd_:

• d3n3vd_ is new in SCOPe 2.06-stable
  
• d3n3vd_ appears in SCOPe 2.07
  
• d3n3vd_ appears in the current release, SCOPe 2.08