Lineage for d1djnb3 (1djn B:341-489,B:646-729)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67446Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
  4. 67447Superfamily c.4.1: Nucleotide-binding domain [51971] (2 families) (S)
  5. 67448Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (3 proteins)
  6. 67468Protein Trimethylamine dehydrogenase, middle domain [51973] (1 species)
  7. 67469Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51974] (3 PDB entries)
  8. 67471Domain d1djnb3: 1djn B:341-489,B:646-729 [30599]
    Other proteins in same PDB: d1djna1, d1djna2, d1djnb1, d1djnb2

Details for d1djnb3

PDB Entry: 1djn (more details), 2.2 Å

PDB Description: structural and biochemical characterization of recombinant wild type trimethylamine dehydrogenase from methylophilus methylotrophus (sp. w3a1)

SCOP Domain Sequences for d1djnb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1djnb3 c.4.1.1 (B:341-489,B:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1}
dirvcigcnvcisrweiggppmictqnatageeyrrgwhpekfrqtknkdsvlivgagps
gseaarvlmesgytvhltdtaekigghlnqvaalpglgewsyhrdyretqitkllkknke
sqlalgqkpmtaddvlqygadkviiatgaXsectlwnelkaresewaendikgiyligda
eaprliadatftghrvareieeanpqiaipykretiawgtphmpggnfkieykv

SCOP Domain Coordinates for d1djnb3:

Click to download the PDB-style file with coordinates for d1djnb3.
(The format of our PDB-style files is described here.)

Timeline for d1djnb3: