SCOPe 2.08: Domain d3mwpa1: 3mwp A:364-561

Lineage for d3mwpa1 (3mwp A:364-561)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
   contains Pfam PF00929

6. Protein Arenavirus nucleoprotein C-terminal domain [310781] (1 species)
   C-terminal half of Pfam PF00843

7. Species Lassa virus Josiah [TaxId:11622] [311037] (3 PDB entries)

8. Domain d3mwpa1: 3mwp A:364-561 [305985]
   Other proteins in same PDB: d3mwpa2, d3mwpb2, d3mwpc2
   complexed with zn

Details for d3mwpa1

PDB Entry: 3mwp, 1.79 Å

PDB Description: Nucleoprotein structure of lassa fever virus

PDB Compounds: (A:) nucleoprotein

SCOPe Domain Sequences for d3mwpa1:

Sequence, based on SEQRES records:

>d3mwpa1 c.55.3.5 (A:364-561) Arenavirus nucleoprotein C-terminal domain {Lassa virus Josiah [TaxId: 11622]}
gltysqlmtlkdamlqldpnaktwmdiegrpedpveialyqpssgcyihffreptdlkqf
kqdakyshgidvtdlfatqpgltsavidalprnmvitcqgsddirkllesqgrkdiklid
ialsktdsrkyenavwdqykdlchmhtgvvvekkkrggkeeitphcalmdcimfdaavsg
glntsvlravlprdmvfr

Sequence, based on observed residues (ATOM records):

>d3mwpa1 c.55.3.5 (A:364-561) Arenavirus nucleoprotein C-terminal domain {Lassa virus Josiah [TaxId: 11622]}
gltysqlmtlkdamlqldpnaktwmdiegrpedpveialyqpssgcyihffreptdlkqf
kqdakyshgidvtdlfatqpgltsavidalprnmvitcqgsddirkllesqgrkdiklid
ialsktdsrkyenavwdqykdlchmhtgvvvekkeeitphcalmdcimfdaavsgglsvl
ravlprdmvfr

Timeline for d3mwpa1:

• d3mwpa1 first appeared in SCOPe 2.06
  
• d3mwpa1 appears in SCOPe 2.07