Lineage for d3lpfb3 (3lpf B:274-601)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2095300Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2095301Protein automated matches [190075] (90 species)
    not a true protein
  7. 2095528Species Escherichia coli [TaxId:83333] [272137] (8 PDB entries)
  8. 2095530Domain d3lpfb3: 3lpf B:274-601 [305835]
    Other proteins in same PDB: d3lpfa1, d3lpfa2, d3lpfa4, d3lpfb1, d3lpfb2, d3lpfb4
    automated match to d5czkb3
    complexed with z77

Details for d3lpfb3

PDB Entry: 3lpf (more details), 2.26 Å

PDB Description: structure of e. coli beta-glucuronidase bound with a novel, potent inhibitor 1-((6,7-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1- (2-hydroxyethyl)-3-(3-methoxyphenyl)thiourea
PDB Compounds: (B:) beta-glucuronidase

SCOPe Domain Sequences for d3lpfb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lpfb3 c.1.8.0 (B:274-601) automated matches {Escherichia coli [TaxId: 83333]}
vavkgeqflinhkpfyftgfgrhedadlrgkgfdnvlmvhdhalmdwigansyrtshypy
aeemldwadehgivvidetaavgfnlslgigfeagnkpkelyseeavngetqqahlqaik
eliardknhpsvvmwsianepdtrpqgareyfaplaeatrkldptrpitcvnvmfcdaht
dtisdlfdvlclnryygwyvqsgdletaekvlekellawqeklhqpiiiteygvdtlagl
hsmytdmwseeyqcawldmyhrvfdrvsavvgeqvwnfadfatsqgilrvggnkkgiftr
drkpksaafllqkrwtgmnfgekpqqgg

SCOPe Domain Coordinates for d3lpfb3:

Click to download the PDB-style file with coordinates for d3lpfb3.
(The format of our PDB-style files is described here.)

Timeline for d3lpfb3: