![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
![]() | Protein automated matches [190075] (90 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [272137] (8 PDB entries) |
![]() | Domain d3lpfb3: 3lpf B:274-601 [305835] Other proteins in same PDB: d3lpfa1, d3lpfa2, d3lpfa4, d3lpfb1, d3lpfb2, d3lpfb4 automated match to d5czkb3 complexed with z77 |
PDB Entry: 3lpf (more details), 2.26 Å
SCOPe Domain Sequences for d3lpfb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lpfb3 c.1.8.0 (B:274-601) automated matches {Escherichia coli [TaxId: 83333]} vavkgeqflinhkpfyftgfgrhedadlrgkgfdnvlmvhdhalmdwigansyrtshypy aeemldwadehgivvidetaavgfnlslgigfeagnkpkelyseeavngetqqahlqaik eliardknhpsvvmwsianepdtrpqgareyfaplaeatrkldptrpitcvnvmfcdaht dtisdlfdvlclnryygwyvqsgdletaekvlekellawqeklhqpiiiteygvdtlagl hsmytdmwseeyqcawldmyhrvfdrvsavvgeqvwnfadfatsqgilrvggnkkgiftr drkpksaafllqkrwtgmnfgekpqqgg
Timeline for d3lpfb3:
![]() Domains from other chains: (mouse over for more information) d3lpfa1, d3lpfa2, d3lpfa3, d3lpfa4 |