Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
Protein automated matches [254633] (19 species) not a true protein |
Species Escherichia coli [TaxId:83333] [272134] (17 PDB entries) |
Domain d3lpfa2: 3lpf A:182-273 [305830] Other proteins in same PDB: d3lpfa1, d3lpfa3, d3lpfa4, d3lpfb1, d3lpfb3, d3lpfb4 automated match to d5czkb2 complexed with z77 |
PDB Entry: 3lpf (more details), 2.26 Å
SCOPe Domain Sequences for d3lpfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lpfa2 b.1.4.0 (A:182-273) automated matches {Escherichia coli [TaxId: 83333]} twvdditvvthvaqdcnhasvdwqvvangdvsvelrdadqqvvatgqgtsgtlqvvnphl wqpgegylyelcvtaksqtecdiyplrvgirs
Timeline for d3lpfa2:
View in 3D Domains from other chains: (mouse over for more information) d3lpfb1, d3lpfb2, d3lpfb3, d3lpfb4 |