Lineage for d3lnab4 (3lna B:1383-1493)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792682Superfamily b.42.5: Actin-crosslinking proteins [50405] (3 families) (S)
  5. 2792683Family b.42.5.1: Fascin [50406] (1 protein)
    automatically mapped to Pfam PF06268
  6. 2792684Protein Fascin [50407] (1 species)
    duplication: tandem repeat of four domains
  7. 2792685Species Human (Homo sapiens) [TaxId:9606] [50408] (18 PDB entries)
  8. 2792793Domain d3lnab4: 3lna B:1383-1493 [305828]
    automated match to d1dfca4
    complexed with 48d

Details for d3lnab4

PDB Entry: 3lna (more details), 2.7 Å

PDB Description: 2.7 Angstrom fascin-macroketone complex crystal structure
PDB Compounds: (B:) fascin

SCOPe Domain Sequences for d3lnab4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lnab4 b.42.5.1 (B:1383-1493) Fascin {Human (Homo sapiens) [TaxId: 9606]}
rpiivfrgehgfigcrkvtgtldanrssydvfqlefndgaynikdstgkywtvgsdsavt
ssgdtpvdfffefcdynkvaikvggrylkgdhagvlkasaetvdpaslwey

SCOPe Domain Coordinates for d3lnab4:

Click to download the PDB-style file with coordinates for d3lnab4.
(The format of our PDB-style files is described here.)

Timeline for d3lnab4: