SCOPe 2.08: Domain d3l4za3: 3l4z A:650-731

Lineage for d3l4za3 (3l4z A:650-731)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (41 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225771] (22 PDB entries)

8. Domain d3l4za3: 3l4z A:650-731 [305785]
   Other proteins in same PDB: d3l4za1, d3l4za2, d3l4za4, d3l4za5
   automated match to d2qlya3
   complexed with gol, nag, ssd

Details for d3l4za3

PDB Entry: 3l4z, 2 Å

PDB Description: crystal complex of n-terminal human maltase-glucoamylase with salacinol

PDB Compounds: (A:) Maltase-glucoamylase, intestinal

SCOPe Domain Sequences for d3l4za3:

Sequence; same for both SEQRES and ATOM records:

>d3l4za3 b.71.1.0 (A:650-731) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvarpllhefyednstwdvhqqflwgpgllitpvldegaekvmayvpdavwydyetgsqv
rwrkqkvemelpgdkiglhlrg

Timeline for d3l4za3:

• d3l4za3 first appeared in SCOPe 2.06
  
• d3l4za3 appears in SCOPe 2.07