Lineage for d3l4va1 (3l4v A:7-269)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781620Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2782125Family b.30.5.0: automated matches [227145] (1 protein)
    not a true family
  6. 2782126Protein automated matches [226849] (8 species)
    not a true protein
  7. 2782234Species Human (Homo sapiens) [TaxId:9606] [311307] (8 PDB entries)
  8. 2782241Domain d3l4va1: 3l4v A:7-269 [305763]
    Other proteins in same PDB: d3l4va2, d3l4va3, d3l4va4, d3l4va5
    automated match to d2qlya1
    complexed with ktl, nag

Details for d3l4va1

PDB Entry: 3l4v (more details), 2.1 Å

PDB Description: crystal complex of n-terminal human maltase-glucoamylase with kotalanol
PDB Compounds: (A:) Maltase-glucoamylase, intestinal

SCOPe Domain Sequences for d3l4va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l4va1 b.30.5.0 (A:7-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vnelerincipdqpptkatcdqrgccwnpqgavsvpwcyysknhsyhvegnlvntnagft
arlknlpsspvfgsnvdnvlltaeyqtsnrfhfkltdqtnnrfevphehvqsfsgnaaas
ltyqveisrqpfsikvtrrsnnrvlfdssigpllfadqflqlstrlpstnvyglgehvhq
qyrhdmnwktwpifnrdttpngngtnlygaqtfflcledasglsfgvflmnsnamevvlq
papaityrtiggildfyvflgnt

SCOPe Domain Coordinates for d3l4va1:

Click to download the PDB-style file with coordinates for d3l4va1.
(The format of our PDB-style files is described here.)

Timeline for d3l4va1: