Class a: All alpha proteins [46456] (289 folds) |
Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
Superfamily a.128.1: Terpenoid synthases [48576] (6 families) duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
Family a.128.1.0: automated matches [196408] (1 protein) not a true family |
Protein automated matches [196409] (37 species) not a true protein |
Species Streptomyces coelicolor [TaxId:100226] [279808] (16 PDB entries) |
Domain d3kbka_: 3kbk A: [305693] automated match to d5dz2a_ complexed with cl, hg, na, so4 |
PDB Entry: 3kbk (more details), 1.9 Å
SCOPe Domain Sequences for d3kbka_:
Sequence, based on SEQRES records: (download)
>d3kbka_ a.128.1.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 100226]} vppslrlpvieaafprqlhpywpklqettrtwllekrlmpadkveeyadglcytdlmagy ylgapdevlqaiadysawffvwddrhdrdivhgragawrrlrgllhtaldspgdhlhhed tlvagfadsvrrlyaflpatwnarfarhfhtvieaydrefhnrtrgivpgveeylelrrl tfahwiwtdllepssgcelpdavrkhpayrraallsqefaawyndlcslpkeiagdevhn lgislithhsltleeaigevrrrveeciteflaverdalrfadeladgtvrgkelsgavr anvgnmrnwfssvywfhhesgry
>d3kbka_ a.128.1.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 100226]} vppslrlpvieaafprqlhpywpklqettrtwllekrlmpadkveeyadglcytdlmagy ylgapdevlqaiadysawffvwddrhdrdivhgragawrrlrgllhtaldspgdhlhhed tlvagfadsvrrlyaflpatwnarfarhfhtvieaydrefhnrtrgivpgeeylelrrlt fahwiwtdllepssgcelpdavrkhpayrraallsqefaawyndlcslpkeiatleeaig evrrrveeciteflaverdalrfadeladgtvrgkelsgavranvgnmrnwfssvywfhh esgry
Timeline for d3kbka_: