SCOPe 2.07: Domain d3kaxa_: 3kax A:

Lineage for d3kaxa_ (3kax A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (160 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:261594] [189194] (4 PDB entries)

8. Domain d3kaxa_: 3kax A: [305688]
   automated match to d4dgta_
   complexed with na, peg, plp

Details for d3kaxa_

PDB Entry: 3kax, 1.7 Å

PDB Description: Crystal structure of a putative C-S lyase from Bacillus anthracis

PDB Compounds: (A:) Aminotransferase, classes I and II

SCOPe Domain Sequences for d3kaxa_:

Sequence; same for both SEQRES and ATOM records:

>d3kaxa_ c.67.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 261594]}
dtykneelihawiadmdfevpqpiqtalkkriehpifgytlppenigdiicnwtkkqynw
diqkewivfsagivpalstsiqaftkenesvlvqppiyppffemvttnnrqlcvsplqkq
ndtyaidfehlekqfqqgvklmllcsphnpigrvwkkeeltklgslctkynvivvadeih
sdiiyadhthtpfaslseelaartitcmapsktfniaglqasiiiipneklrqaftsiqy
rqgfhglnifaytamqsaytecndwlneirfyiednakfaceyikdhiptlsvmkpegsf
llwidcsalnlsqdertklleekgkiivepgekyglggeehiginigcprsvleeilnrl
rhtfs

Timeline for d3kaxa_:

• d3kaxa_ first appeared in SCOPe 2.06
  
• d3kaxa_ appears in the current release, SCOPe 2.08