Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
Protein automated matches [227126] (21 species) not a true protein |
Species Bacillus anthracis [TaxId:261594] [255872] (3 PDB entries) |
Domain d3k95a1: 3k95 A:2-337 [305680] Other proteins in same PDB: d3k95a3, d3k95b3 automated match to d3m49a1 complexed with acy, btb, cl, fmt, gol, mg, peg, pg5, so4, tdp |
PDB Entry: 3k95 (more details), 2 Å
SCOPe Domain Sequences for d3k95a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k95a1 c.36.1.0 (A:2-337) automated matches {Bacillus anthracis [TaxId: 261594]} shsieqlsintirtlsidaiekansghpgmpmgaapmaytlwtqfmkhnpnnptwfnrdr fvlsaghgsmllysllhlsgydvtmddlknfrqwgsktpghpeyghtagvdattgplgqg iatavgmamaerhlaakynrdaynivdhytyaicgdgdlmegvsaeasslaahlqlgrlv vlydsndisldgdlnrsfsesvedrykaygwqvirvedgndieaiakaieeakadekrpt lievrttigfgspnksgksashgsplgveetkltkeayawtaeqdfhvaeevyenfrktv qdvgetaqaewntmlgeyaqaypelanelqaamngl
Timeline for d3k95a1: