Lineage for d3k5bb_ (3k5b B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040739Superfamily h.1.37: V-type ATPase peripheral stalk subunit G coiled coil [310579] (1 family) (S)
    Unusual right-handed coiled coil noted in PubMed 20173764
  5. 3040740Family h.1.37.1: V-type ATPase peripheral stalk subunit G coiled coil [310619] (2 proteins)
  6. 3040741Protein V-type ATPase peripheral stalk subunit G coiled coil [310712] (2 species)
  7. 3040746Species Thermus thermophilus HB8 [TaxId:300852] [310950] (1 PDB entry)
  8. 3040747Domain d3k5bb_: 3k5b B: [305675]
    Other proteins in same PDB: d3k5ba1, d3k5ba2, d3k5be1, d3k5be2

Details for d3k5bb_

PDB Entry: 3k5b (more details), 3.1 Å

PDB Description: crystal structure of the peripheral stalk of thermus thermophilus h+- atpase/synthase
PDB Compounds: (B:) V-type ATP synthase, subunit (VAPC-THERM)

SCOPe Domain Sequences for d3k5bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k5bb_ h.1.37.1 (B:) V-type ATPase peripheral stalk subunit G coiled coil {Thermus thermophilus HB8 [TaxId: 300852]}
glikslaekekqllerleaakkeaeervkraeaeakalleeaeakakaleaqyrererae
teallaryreraeaeakavrekamarldeavalvlkevlp

SCOPe Domain Coordinates for d3k5bb_:

Click to download the PDB-style file with coordinates for d3k5bb_.
(The format of our PDB-style files is described here.)

Timeline for d3k5bb_: