Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.37: V-type ATPase peripheral stalk subunit G coiled coil [310579] (1 family) Unusual right-handed coiled coil noted in PubMed 20173764 |
Family h.1.37.1: V-type ATPase peripheral stalk subunit G coiled coil [310619] (2 proteins) |
Protein V-type ATPase peripheral stalk subunit G coiled coil [310712] (2 species) |
Species Thermus thermophilus HB8 [TaxId:300852] [310950] (1 PDB entry) |
Domain d3k5bb_: 3k5b B: [305675] Other proteins in same PDB: d3k5ba1, d3k5ba2, d3k5be1, d3k5be2 |
PDB Entry: 3k5b (more details), 3.1 Å
SCOPe Domain Sequences for d3k5bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k5bb_ h.1.37.1 (B:) V-type ATPase peripheral stalk subunit G coiled coil {Thermus thermophilus HB8 [TaxId: 300852]} glikslaekekqllerleaakkeaeervkraeaeakalleeaeakakaleaqyrererae teallaryreraeaeakavrekamarldeavalvlkevlp
Timeline for d3k5bb_: