Lineage for d1d7ya2 (1d7y A:116-236)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 20781Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 20782Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 20948Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (9 proteins)
  6. 21064Protein NADH-dependent ferredoxin reductase, BphA4 [51957] (1 species)
  7. 21065Species Pseudomonas sp., KKS102 [TaxId:306] [51958] (1 PDB entry)
  8. 21067Domain d1d7ya2: 1d7y A:116-236 [30566]
    Other proteins in same PDB: d1d7ya3

Details for d1d7ya2

PDB Entry: 1d7y (more details), 2.1 Å

PDB Description: crystal structure of nadh-dependent ferredoxin reductase, bpha4

SCOP Domain Sequences for d1d7ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102}
lptlqgatmpvhtlrtledarriqaglrpqsrllivgggviglelaatartagvhvslve
tqprlmsraapatladfvaryhaaqgvdlrfersvtgsvdgvvllddgtriaadmvvvgi
g

SCOP Domain Coordinates for d1d7ya2:

Click to download the PDB-style file with coordinates for d1d7ya2.
(The format of our PDB-style files is described here.)

Timeline for d1d7ya2: