Lineage for d3k46b1 (3k46 B:1-181)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2046279Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2046280Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2047120Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2047121Protein automated matches [190770] (37 species)
    not a true protein
  7. 2047287Species Escherichia coli [TaxId:83333] [272122] (8 PDB entries)
  8. 2047295Domain d3k46b1: 3k46 B:1-181 [305653]
    Other proteins in same PDB: d3k46a2, d3k46a3, d3k46a4, d3k46b2, d3k46b3, d3k46b4
    automated match to d5czkb1

Details for d3k46b1

PDB Entry: 3k46 (more details), 2.5 Å

PDB Description: crystal structure of full-length e. coli beta-glucuronidase
PDB Compounds: (B:) beta-glucuronidase

SCOPe Domain Sequences for d3k46b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k46b1 b.18.1.0 (B:1-181) automated matches {Escherichia coli [TaxId: 83333]}
mlrpvetptreikkldglwafsldrencgidqrwwesalqesraiavpgsfndqfadadi
rnyagnvwyqrevfipkgwagqrivlrfdavthygkvwvnnqevmehqggytpfeadvtp
yviagksvritvcvnnelnwqtippgmvitdengkkkqsyfhdffnyagihrsvmlyttp
n

SCOPe Domain Coordinates for d3k46b1:

Click to download the PDB-style file with coordinates for d3k46b1.
(The format of our PDB-style files is described here.)

Timeline for d3k46b1: