Lineage for d3j9tg1 (3j9t G:98-224)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2203126Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2203758Superfamily d.81.4: V-type ATPase subunit E-like [160527] (1 family) (S)
    extra N-terminal helix and extra C-terminal helix form dimerisation subdomain
  5. 2203759Family d.81.4.1: V-type ATPase subunit E C-terminal domain [160528] (1 protein)
    Pfam PF01991
  6. 2203760Protein V-type ATPase subunit E C-terminal domain [160529] (3 species)
  7. 2203761Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310947] (3 PDB entries)
  8. 2203765Domain d3j9tg1: 3j9t G:98-224 [305610]
    Other proteins in same PDB: d3j9ta1, d3j9ta2, d3j9ta3, d3j9ta4, d3j9tb1, d3j9tb2, d3j9tb3, d3j9tc1, d3j9tc2, d3j9tc3, d3j9tc4, d3j9td1, d3j9td2, d3j9td3, d3j9te1, d3j9te2, d3j9te3, d3j9te4, d3j9tf1, d3j9tf2, d3j9tf3, d3j9tg2, d3j9th_, d3j9ti2, d3j9tj_, d3j9tk2, d3j9tl_, d3j9tm_, d3j9tn_, d3j9to_, d3j9tp_, d3j9tq_, d3j9tr1, d3j9tr2, d3j9ts1, d3j9ts2, d3j9tt1, d3j9tt2, d3j9tu1, d3j9tu2, d3j9tv1, d3j9tv2, d3j9tw1, d3j9tw2, d3j9tx1, d3j9tx2, d3j9ty1, d3j9ty2, d3j9tz1, d3j9tz2

Details for d3j9tg1

PDB Entry: 3j9t (more details), 6.9 Å

PDB Description: yeast v-atpase state 1
PDB Compounds: (G:) V-type proton ATPase subunit E

SCOPe Domain Sequences for d3j9tg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3j9tg1 d.81.4.1 (G:98-224) V-type ATPase subunit E C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gifeetkeklsgiannrdeykpilqsliveallkllepkaivkalerdvdliesmkddim
reygekaqrapleeivisndylnkdlvsggvvvsnasdkieinntleerlkllseealpa
irlelyg

SCOPe Domain Coordinates for d3j9tg1:

Click to download the PDB-style file with coordinates for d3j9tg1.
(The format of our PDB-style files is described here.)

Timeline for d3j9tg1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3j9tg2
View in 3D
Domains from other chains:
(mouse over for more information)
d3j9ta1, d3j9ta2, d3j9ta3, d3j9ta4, d3j9tb1, d3j9tb2, d3j9tb3, d3j9tc1, d3j9tc2, d3j9tc3, d3j9tc4, d3j9td1, d3j9td2, d3j9td3, d3j9te1, d3j9te2, d3j9te3, d3j9te4, d3j9tf1, d3j9tf2, d3j9tf3, d3j9th_, d3j9ti1, d3j9ti2, d3j9tj_, d3j9tk1, d3j9tk2, d3j9tl_, d3j9tm_, d3j9tn_, d3j9to_, d3j9tp_, d3j9tq_, d3j9tr1, d3j9tr2, d3j9ts1, d3j9ts2, d3j9tt1, d3j9tt2, d3j9tu1, d3j9tu2, d3j9tv1, d3j9tv2, d3j9tw1, d3j9tw2, d3j9tx1, d3j9tx2, d3j9ty1, d3j9ty2, d3j9tz1, d3j9tz2