SCOPe 2.07: Domain d3ikja2: 3ikj A:114-190

Lineage for d3ikja2 (3ikj A:114-190)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.5: V1 ATP synthase A subunit, bulge domain-like [310577] (1 family)
   PubMed 19893485

5. Family b.84.5.1: V1 ATP synthase A subunit, bulge domain-like [310616] (2 proteins)

6. Protein A1 ATP synthase A subunit, bulge domain [310707] (2 species)

7. Species Pyrococcus horikoshii OT3 [TaxId:70601] [310937] (1 PDB entry)

8. Domain d3ikja2: 3ikj A:114-190 [305566]
   Other proteins in same PDB: d3ikja1, d3ikja3
   complexed with mpd, trs; mutant

Details for d3ikja2

PDB Entry: 3ikj, 2.4 Å

PDB Description: structural characterization for the nucleotide binding ability of subunit a mutant s238a of the a1ao atp synthase

PDB Compounds: (A:) V-type ATP synthase alpha chain

SCOPe Domain Sequences for d3ikja2:

Sequence; same for both SEQRES and ATOM records:

>d3ikja2 b.84.5.1 (A:114-190) A1 ATP synthase A subunit, bulge domain {Pyrococcus horikoshii OT3 [TaxId: 70601]}
rdkkwhfipkakvgdkvvggdiigevpetsiivhkimvppgiegeiveiaeegdytieev
iakvktpsgeikelkmy

Timeline for d3ikja2:

• d3ikja2 first appeared in SCOPe 2.06