Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.0: automated matches [191327] (1 protein) not a true family |
Protein automated matches [190150] (36 species) not a true protein |
Species Salmonella enterica [TaxId:99287] [311298] (1 PDB entry) |
Domain d3ihnc_: 3ihn C: [305563] automated match to d3pnua_ complexed with acy, bme, cl, pg4, pge, zn |
PDB Entry: 3ihn (more details), 1.8 Å
SCOPe Domain Sequences for d3ihnc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ihnc_ c.1.9.0 (C:) automated matches {Salmonella enterica [TaxId: 99287]} sqvlkirrpddwhvhlrdgdmlktvvpytseiygraivmpnlaspittvdaaiayrqril davpaghdftplmtcyltdsldadelergfhegvftaaklypanattnsshgvtsvdaim pvlermeklgipllvhgevthadvdifdrearfidtvmeplrqrltalkvvfehittkda aqyvrdgndylaatitpqhlmfnrndmlvggirphlyclpilkrnihqqalrelvasgft raflgtdsaphsrhrketscgcagcfnapsalgsyaavfeemnalahfeafcslngpqfy glpmntgwvelvrdeqqipgnialaddslvpflagetvrwsvkk
Timeline for d3ihnc_: