Lineage for d3ihnc_ (3ihn C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2833366Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2834067Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 2834068Protein automated matches [190150] (36 species)
    not a true protein
  7. 2834269Species Salmonella enterica [TaxId:99287] [311298] (1 PDB entry)
  8. 2834272Domain d3ihnc_: 3ihn C: [305563]
    automated match to d3pnua_
    complexed with acy, bme, cl, pg4, pge, zn

Details for d3ihnc_

PDB Entry: 3ihn (more details), 1.8 Å

PDB Description: 1.8 Angstrom resolution crystal structure of dihydroorotase (pyrc) from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
PDB Compounds: (C:) dihydroorotase

SCOPe Domain Sequences for d3ihnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ihnc_ c.1.9.0 (C:) automated matches {Salmonella enterica [TaxId: 99287]}
sqvlkirrpddwhvhlrdgdmlktvvpytseiygraivmpnlaspittvdaaiayrqril
davpaghdftplmtcyltdsldadelergfhegvftaaklypanattnsshgvtsvdaim
pvlermeklgipllvhgevthadvdifdrearfidtvmeplrqrltalkvvfehittkda
aqyvrdgndylaatitpqhlmfnrndmlvggirphlyclpilkrnihqqalrelvasgft
raflgtdsaphsrhrketscgcagcfnapsalgsyaavfeemnalahfeafcslngpqfy
glpmntgwvelvrdeqqipgnialaddslvpflagetvrwsvkk

SCOPe Domain Coordinates for d3ihnc_:

Click to download the PDB-style file with coordinates for d3ihnc_.
(The format of our PDB-style files is described here.)

Timeline for d3ihnc_: