Lineage for d3hr7a_ (3hr7 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2128586Species Helicobacter pylori [TaxId:85962] [311198] (5 PDB entries)
  8. 2128587Domain d3hr7a_: 3hr7 A: [305529]
    automated match to d4y0aa_
    complexed with so4

Details for d3hr7a_

PDB Entry: 3hr7 (more details), 1.8 Å

PDB Description: Crystal structure of the shikimate kinase-sulfate complex from Helicobacter pylori
PDB Compounds: (A:) Shikimate kinase

SCOPe Domain Sequences for d3hr7a_:

Sequence, based on SEQRES records: (download)

>d3hr7a_ c.37.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
mqhlvligfmgsgksslaqelglalklevldtdmiiservglsvreifeelgednfrmfe
knlidelktlktphvistgggivmhenlkglgttfylkmdfetlikrlnqkerekrplln
nltqakelfekrqalyeknasfiidargglnnslkqvlqfia

Sequence, based on observed residues (ATOM records): (download)

>d3hr7a_ c.37.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
mqhlvligfmgsgksslaqelglalklevldtdmiiservglsvreifeelgednfrmfe
knlidelktlktphvistgggivmhenlkglgttfylkmdfetlikrlnnltqakelfek
rqalyeknasfiidargglnnslkqvlqfia

SCOPe Domain Coordinates for d3hr7a_:

Click to download the PDB-style file with coordinates for d3hr7a_.
(The format of our PDB-style files is described here.)

Timeline for d3hr7a_: