Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) |
Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
Protein Thioredoxin reductase [51950] (2 species) lacks the "interface" C-terminal alpha+beta domain |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [51952] (1 PDB entry) |
Domain d1vdca2: 1vdc A:118-243 [30546] complexed with fad, so4 |
PDB Entry: 1vdc (more details), 2.5 Å
SCOPe Domain Sequences for d1vdca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} rlsfvgsgevlggfwnrgisacavcdgaapifrnkplavigggdsameeanfltkygskv yiihrrdafraskimqqralsnpkidviwnssvveaygdgerdvlgglkvknvvtgdvsd lkvsglffai
Timeline for d1vdca2: