Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) |
Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (9 proteins) |
Protein Thioredoxin reductase [51950] (2 species) |
Species Escherichia coli [TaxId:562] [51951] (5 PDB entries) |
Domain d1f6mf2: 1f6m F:119-244 [30544] Other proteins in same PDB: d1f6mc_, d1f6md_, d1f6mg_, d1f6mh_ |
PDB Entry: 1f6m (more details), 2.95 Å
SCOP Domain Sequences for d1f6mf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f6mf2 c.3.1.5 (F:119-244) Thioredoxin reductase {Escherichia coli} lglpseeafkgrgvsasatcdgffyrnqkvavigggntaveealylsniasevhlihrrd gfraekilikrlmdkvengniilhtnrtleevtgdqmgvtgvrlrdtqnsdniesldvag lfvaig
Timeline for d1f6mf2: