Lineage for d1f6mf2 (1f6m F:119-244)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 20781Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 20782Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 20948Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (9 proteins)
  6. 21068Protein Thioredoxin reductase [51950] (2 species)
  7. 21069Species Escherichia coli [TaxId:562] [51951] (5 PDB entries)
  8. 21085Domain d1f6mf2: 1f6m F:119-244 [30544]
    Other proteins in same PDB: d1f6mc_, d1f6md_, d1f6mg_, d1f6mh_

Details for d1f6mf2

PDB Entry: 1f6m (more details), 2.95 Å

PDB Description: crystal structure of a complex between thioredoxin reductase, thioredoxin, and the nadp+ analog, aadp+

SCOP Domain Sequences for d1f6mf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f6mf2 c.3.1.5 (F:119-244) Thioredoxin reductase {Escherichia coli}
lglpseeafkgrgvsasatcdgffyrnqkvavigggntaveealylsniasevhlihrrd
gfraekilikrlmdkvengniilhtnrtleevtgdqmgvtgvrlrdtqnsdniesldvag
lfvaig

SCOP Domain Coordinates for d1f6mf2:

Click to download the PDB-style file with coordinates for d1f6mf2.
(The format of our PDB-style files is described here.)

Timeline for d1f6mf2: