Lineage for d3gqbc1 (3gqb C:1-70)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2067173Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 2067174Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2067364Family b.49.1.2: N-terminal domain of A and B subunits of V1 ATP synthase [310615] (2 proteins)
  6. 2067365Protein V1 ATP synthase A subunit, domain 1 [310701] (2 species)
    Pfam PF16886
  7. 2067370Species Thermus thermophilus HB8 [TaxId:300852] [310924] (2 PDB entries)
  8. 2067372Domain d3gqbc1: 3gqb C:1-70 [305433]
    Other proteins in same PDB: d3gqba2, d3gqba3, d3gqba4, d3gqbb1, d3gqbb2, d3gqbb3, d3gqbc2, d3gqbc3, d3gqbc4, d3gqbd1, d3gqbd2, d3gqbd3

Details for d3gqbc1

PDB Entry: 3gqb (more details), 2.8 Å

PDB Description: crystal structure of the a3b3 complex from v-atpase
PDB Compounds: (C:) V-type ATP synthase alpha chain

SCOPe Domain Sequences for d3gqbc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gqbc1 b.49.1.2 (C:1-70) V1 ATP synthase A subunit, domain 1 {Thermus thermophilus HB8 [TaxId: 300852]}
miqgviqkiagpaviakgmlgarmydiskvgeeglvgeiirldgdtafvqvyedtsglkv
gepvvstglp

SCOPe Domain Coordinates for d3gqbc1:

Click to download the PDB-style file with coordinates for d3gqbc1.
(The format of our PDB-style files is described here.)

Timeline for d3gqbc1: