Class b: All beta proteins [48724] (177 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) automatically mapped to Pfam PF02874 |
Family b.49.1.2: N-terminal domain of A and B subunits of V1 ATP synthase [310615] (2 proteins) |
Protein V1 ATP synthase A subunit, domain 1 [310701] (2 species) Pfam PF16886 |
Species Thermus thermophilus HB8 [TaxId:300852] [310924] (2 PDB entries) |
Domain d3gqbc1: 3gqb C:1-70 [305433] Other proteins in same PDB: d3gqba2, d3gqba3, d3gqba4, d3gqbb1, d3gqbb2, d3gqbb3, d3gqbc2, d3gqbc3, d3gqbc4, d3gqbd1, d3gqbd2, d3gqbd3 |
PDB Entry: 3gqb (more details), 2.8 Å
SCOPe Domain Sequences for d3gqbc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gqbc1 b.49.1.2 (C:1-70) V1 ATP synthase A subunit, domain 1 {Thermus thermophilus HB8 [TaxId: 300852]} miqgviqkiagpaviakgmlgarmydiskvgeeglvgeiirldgdtafvqvyedtsglkv gepvvstglp
Timeline for d3gqbc1: