SCOP 1.73: Domain d1f6me2: 1f6m E:119-244

Lineage for d1f6me2 (1f6m E:119-244)

Root: SCOP 1.73
Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (7 families)

Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
duplication: both domains have similar folds and functions
most members of the family contain common C-terminal alpha+beta domain

Protein Thioredoxin reductase [51950] (2 species)
lacks the "interface" C-terminal alpha+beta domain
Species Escherichia coli [TaxId:562] [51951] (5 PDB entries)
Domain d1f6me2: 1f6m E:119-244 [30542]
Other proteins in same PDB: d1f6mc_, d1f6md_, d1f6mg_, d1f6mh_

Details for d1f6me2

PDB Entry: 1f6m (more details), 2.95 Å

PDB Description: crystal structure of a complex between thioredoxin reductase, thioredoxin, and the nadp+ analog, aadp+

PDB Compounds: (E:) thioredoxin reductase

SCOP Domain Sequences for d1f6me2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f6me2 c.3.1.5 (E:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]}
lglpseeafkgrgvsasatcdgffyrnqkvavigggntaveealylsniasevhlihrrd
gfraekilikrlmdkvengniilhtnrtleevtgdqmgvtgvrlrdtqnsdniesldvag
lfvaig

SCOP Domain Coordinates for d1f6me2:

Click to download the PDB-style file with coordinates for d1f6me2.
(The format of our PDB-style files is described here.)

Timeline for d1f6me2: