Lineage for d1cl0a1 (1cl0 A:1-118,A:245-317)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 388822Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 388823Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 389137Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (12 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 389316Protein Thioredoxin reductase [51950] (2 species)
    lacks the "interface" C-terminal alpha+beta domain
  7. 389317Species Escherichia coli [TaxId:562] [51951] (5 PDB entries)
  8. 389320Domain d1cl0a1: 1cl0 A:1-118,A:245-317 [30535]

Details for d1cl0a1

PDB Entry: 1cl0 (more details), 2.5 Å

PDB Description: crystal structure of reduced thioredoxin reductase from escherichia coli.

SCOP Domain Sequences for d1cl0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cl0a1 c.3.1.5 (A:1-118,A:245-317) Thioredoxin reductase {Escherichia coli}
gttkhskllilgsgpagytaavyaaranlqpvlitgmekggqlttttevenwpgdpndlt
gpllmermhehatkfeteiifdhinkvdlqnrpfrlngdngeytcdaliiatgasaryXh
spntaifegqlelengyikvqsgihgnatqtsipgvfaagdvmdhiyrqaitsagtgcma
aldaeryldgla

SCOP Domain Coordinates for d1cl0a1:

Click to download the PDB-style file with coordinates for d1cl0a1.
(The format of our PDB-style files is described here.)

Timeline for d1cl0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cl0a2