SCOPe 2.06: Domain d1tdfa2: 1tdf A:119-244

Lineage for d1tdfa2 (1tdf A:119-244)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
   duplication: both domains have similar folds and functions
   most members of the family contain common C-terminal alpha+beta domain

6. Protein Thioredoxin reductase [51950] (2 species)
   lacks the "interface" C-terminal alpha+beta domain

7. Species Escherichia coli [TaxId:562] [51951] (5 PDB entries)

8. Domain d1tdfa2: 1tdf A:119-244 [30534]
   complexed with fad, nap

Details for d1tdfa2

PDB Entry: 1tdf, 2.3 Å

PDB Description: crystal structure of escherichia coli thioredoxin reductase refined at 2 angstrom resolution: implications for a large conformational change during catalysis

PDB Compounds: (A:) thioredoxin reductase

SCOPe Domain Sequences for d1tdfa2:

Sequence; same for both SEQRES and ATOM records:

>d1tdfa2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]}
lglpseeafkgrgvsacatsdgffyrnqkvavigggntaveealylsniasevhlihrrd
gfraekilikrlmdkvengniilhtnrtleevtgdqmgvtgvrlrdtqnsdniesldvag
lfvaig

Timeline for d1tdfa2:

• d1tdfa2 first appeared (with stable ids) in SCOP 1.55, called d1tdf_2
  
• d1tdfa2 appears in SCOPe 2.05
  
• d1tdfa2 appears in SCOPe 2.07
  
• d1tdfa2 appears in the current release, SCOPe 2.08