Lineage for d3evlb1 (3evl B:6-355)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722434Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) (S)
    incomplete toroid
  5. 2722435Family a.102.3.1: Alginate lyase A1-III [48231] (1 protein)
  6. 2722436Protein Alginate lyase A1-III [48232] (1 species)
  7. 2722437Species Sphingomonas sp., A1 [TaxId:28214] [48233] (8 PDB entries)
  8. 2722446Domain d3evlb1: 3evl B:6-355 [305314]
    Other proteins in same PDB: d3evla2, d3evlb2
    automated match to d4f10a_

Details for d3evlb1

PDB Entry: 3evl (more details), 2.2 Å

PDB Description: Alginate lyase A1-III H192A complexed with tetrasaccharide
PDB Compounds: (B:) Alginate lyase

SCOPe Domain Sequences for d3evlb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3evlb1 a.102.3.1 (B:6-355) Alginate lyase A1-III {Sphingomonas sp., A1 [TaxId: 28214]}
hpfdqavvkdptasyvdvkarrtflqsgqlddrlkaalpkeydctteatpnpqqgemvip
rrylsgnhgpvnpdyepvvtlyrdfekisatlgnlyvatgkpvyatcllnmldkwakada
llnydpksqswyqvewsaataafalstmmaepnvdtaqrervvkwlnrvarhqtsfpggd
tsccnnasywrgqeatiigviskddelfrwglgryvqamglinedgsfvhemtrheqslh
yqnyamlpltmiaetasrqgidlyaykengrdihsarkfvfaavknpdlikkyasepqdt
rafkpgrgdlnwieyqrarfgfadelgfmtvpifdprtggsatllaykpq

SCOPe Domain Coordinates for d3evlb1:

Click to download the PDB-style file with coordinates for d3evlb1.
(The format of our PDB-style files is described here.)

Timeline for d3evlb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3evlb2