SCOPe 2.06: Domain d3etfb_: 3etf B:

Lineage for d3etfb_ (3etf B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.82: ALDH-like [53719] (1 superfamily)
   consists of two similar domains with 3 layers (a/b/a) each; duplication
   core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.82.1: ALDH-like [53720] (3 families)
   binds NAD differently from other NAD(P)-dependent oxidoreductases

5. Family c.82.1.0: automated matches [191448] (1 protein)
   not a true family

6. Protein automated matches [190683] (49 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:602] [311283] (2 PDB entries)

8. Domain d3etfb_: 3etf B: [305300]
   automated match to d4i26c_

Details for d3etfb_

PDB Entry: 3etf, 1.85 Å

PDB Description: crystal structure of a putative succinate-semialdehyde dehydrogenase from salmonella typhimurium lt2

PDB Compounds: (B:) Putative succinate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d3etfb_:

Sequence; same for both SEQRES and ATOM records:

>d3etfb_ c.82.1.0 (B:) automated matches {Salmonella typhimurium [TaxId: 602]}
tqalsvnpatgqtlaampwanaqeiehalslaasgfkkwkmtsvaqraqtlrdigqalra
haeemaqcitremgkpikqaraevtksaalcdwyaehgpamlnpeptlvenqqavieyrp
lgvilaimpwnfplwqvlrgavpillagnsyllkhapnvtgcaqmiarilaeagtpagvy
gwvnannegvsqmindpriaavtvtgsvragaaigaqagaalkkcvlelggsdpfivlnd
adlelavkaavagryqntgqvcaaakrfiveegiaqaftdrfvaaaaalkmgdplveend
lgpmarfdlrdelhqqvqasvaegarlllggekiagegnyyaatvladvtpdmtafrqel
fgpvaaitvakdaahalalandsefglsatiftaddtlaaemaarlecggvfingysasd
arvafggvkksgfgrelshfglhefcnvqtvwknrv

Timeline for d3etfb_:

• d3etfb_ is new in SCOPe 2.06-stable
  
• d3etfb_ appears in SCOPe 2.07
  
• d3etfb_ appears in the current release, SCOPe 2.08