SCOPe 2.06: Domain d3endb_: 3end B:

Lineage for d3endb_ (3end B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:272943] [267835] (2 PDB entries)

8. Domain d3endb_: 3end B: [305295]
   automated match to d3fwya_
   complexed with adp, mg, sf4

Details for d3endb_

PDB Entry: 3end, 1.63 Å

PDB Description: Crystal structure of the L protein of Rhodobacter sphaeroides light-independent protochlorophyllide reductase (BchL) with MgADP bound: a homologue of the nitrogenase Fe protein

PDB Compounds: (B:) Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

SCOPe Domain Sequences for d3endb_:

Sequence; same for both SEQRES and ATOM records:

>d3endb_ c.37.1.0 (B:) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
gakvfavygkggigksttssnlsaafsilgkrvlqigcdpkhdstftltgslvptvidvl
kdvdfhpeelrpedfvfegfngvmcveaggppagtgcggyvvgqtvkllkqhhllddtdv
vifdvlgdvvcggfaaplqhadqavvvtandfdsiyamnriiaavqaksknykvrlagcv
anrsratdevdrfcketnfrrlahmpdldairrsrlkkktlfemdedqdvlaaraeyirl
aeslwrgldpidphslpdrdifellgfd

Timeline for d3endb_:

• d3endb_ is new in SCOPe 2.06-stable
  
• d3endb_ appears in SCOPe 2.07
  
• d3endb_ appears in the current release, SCOPe 2.08