SCOPe 2.08: Domain d1trba1: 1trb A:1-118,A:245-316

Lineage for d1trba1 (1trb A:1-118,A:245-316)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
   duplication: both domains have similar folds and functions
   most members of the family contain common C-terminal alpha+beta domain

6. Protein Thioredoxin reductase [51950] (2 species)
   lacks the "interface" C-terminal alpha+beta domain

7. Species Escherichia coli [TaxId:562] [51951] (5 PDB entries)

8. Domain d1trba1: 1trb A:1-118,A:245-316 [30529]
   complexed with fad
   missing some secondary structures that made up less than one-third of the common domain

Details for d1trba1

PDB Entry: 1trb, 2 Å

PDB Description: convergent evolution of similar function in two structurally divergent enzymes

PDB Compounds: (A:) thioredoxin reductase

SCOPe Domain Sequences for d1trba1:

Sequence; same for both SEQRES and ATOM records:

>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]}
gttkhskllilgsgpagytaavyaaranlqpvlitgmekggqlttttevenwpgdpndlt
gpllmermhehatkfeteiifdhinkvdlqnrpfrlngdngeytcdaliiatgasaryXh
spntaifegqlelengyikvqsgihgnatqtsipgvfaagdvmdhiyrqaitsagtgcma
aldaeryldgl

Timeline for d1trba1:

• d1trba1 first appeared (with stable ids) in SCOP 1.55, called d1trb_1
  
• d1trba1 appears in SCOPe 2.07