Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (160 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267816] (20 PDB entries) |
Domain d3ei6b1: 3ei6 B:19-426 [305266] Other proteins in same PDB: d3ei6a2, d3ei6b2 automated match to d3ei5a_ complexed with gol, pl4, so4 |
PDB Entry: 3ei6 (more details), 1.9 Å
SCOPe Domain Sequences for d3ei6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ei6b1 c.67.1.0 (B:19-426) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} eyktkvsrnsnmsklqagylfpeiarrrsahllkypdaqvislgigdttepipevitsam akkahelstiegysgygaeqgakplraaiaktfygglgigdddvfvsdgakcdisrlqvm fgsnvtiavqdpsypayvdssvimgqtgqfntdvqkygnieymrctpengffpdlstvgr tdiiffcspnnptgaaatreqltqlvefakkngsiivydsayamymsddnprsifeipga eevametasfskyagftgvrlgwtvipkkllysdgfpvakdfnriictcfngasnisqag alacltpegleamhkvigfykentniiidtftslgydvyggknapyvwvhfpnqsswdvf aeilekthvvttpgsgfgpggegfvrvsafghrenileacrrfkqlyk
Timeline for d3ei6b1: