Lineage for d1ndaa2 (1nda A:170-286)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 20781Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 20782Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 20948Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (9 proteins)
  6. 21089Protein Trypanothione reductase [51947] (2 species)
  7. 21119Species Trypanosoma cruzi [TaxId:5693] [51949] (3 PDB entries)
  8. 21129Domain d1ndaa2: 1nda A:170-286 [30526]
    Other proteins in same PDB: d1ndaa3, d1ndab3

Details for d1ndaa2

PDB Entry: 1nda (more details), 3.3 Å

PDB Description: the structure of trypanosoma cruzi trypanothione reductase in the oxidized and nadph reduced state

SCOP Domain Sequences for d1ndaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndaa2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi}
pgiehcissneafylpepprrvltvgggfisvefagifnaykpkdgqvtlcyrgemilrg
fdhtlreeltkqltangiqiltkenpakvelnadgsksvtfesgkkmdfdlvmmaig

SCOP Domain Coordinates for d1ndaa2:

Click to download the PDB-style file with coordinates for d1ndaa2.
(The format of our PDB-style files is described here.)

Timeline for d1ndaa2: