Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins) C-terminal part of Pfam PF08715 |
Protein automated matches [310868] (5 species) not a true protein |
Species SARS coronavirus [TaxId:227859] [311282] (4 PDB entries) |
Domain d3e9sa2: 3e9s A:63-315 [305253] Other proteins in same PDB: d3e9sa1, d3e9sa3 automated match to d2fe8a2 complexed with cl, ttt, zn |
PDB Entry: 3e9s (more details), 2.5 Å
SCOPe Domain Sequences for d3e9sa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e9sa2 d.3.1.23 (A:63-315) automated matches {SARS coronavirus [TaxId: 227859]} dtlrseafeyyhtldesflgrymsalnhtkkwkfpqvggltsikwadnncylssvllalq qlevkfnapalqeayyraragdaanfcalilaysnktvgelgdvretmthllqhanlesa krvlnvvckhcgqktttltgveavmymgtlsydnlktgvsipcvcgrdatqylvqqessf vmmsappaeyklqqgtflcaneytgnyqcghythitaketlyridgahltkmseykgpvt dvfyketsyttti
Timeline for d3e9sa2: