Lineage for d3dsra3 (3dsr A:351-457)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717309Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. 2717538Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 2717539Protein automated matches [254528] (17 species)
    not a true protein
  7. 2717651Species Methanosarcina mazei [TaxId:2209] [311243] (3 PDB entries)
  8. 2717654Domain d3dsra3: 3dsr A:351-457 [305234]
    Other proteins in same PDB: d3dsra1, d3dsra2, d3dsrb1, d3dsrb2
    automated match to d3j9tb3
    complexed with adp

Details for d3dsra3

PDB Entry: 3dsr (more details), 2.7 Å

PDB Description: ADP in transition binding site in the subunit B of the energy converter A1Ao ATP synthase
PDB Compounds: (A:) V-type ATP synthase beta chain

SCOPe Domain Sequences for d3dsra3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dsra3 a.69.1.0 (A:351-457) automated matches {Methanosarcina mazei [TaxId: 2209]}
mnsgigagktredhkavsdqmyagyaegrdlrglvaivgkealserdtkflefadlfedk
fvrqgrnenrtiedtleigwqilthlpenqlgridnkyiqkyhpahr

SCOPe Domain Coordinates for d3dsra3:

Click to download the PDB-style file with coordinates for d3dsra3.
(The format of our PDB-style files is described here.)

Timeline for d3dsra3: