Lineage for d3dfhb1 (3dfh B:4-117)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2191243Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2191244Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2191540Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2191541Protein automated matches [226922] (88 species)
    not a true protein
  7. 2192292Species Vibrionales bacterium [TaxId:391574] [267877] (3 PDB entries)
  8. 2192306Domain d3dfhb1: 3dfh B:4-117 [305206]
    Other proteins in same PDB: d3dfha2, d3dfha3, d3dfhb2, d3dfhb3, d3dfhc2, d3dfhc3
    automated match to d3qkea1
    complexed with na

Details for d3dfhb1

PDB Entry: 3dfh (more details), 2.2 Å

PDB Description: crystal structure of putative mandelate racemase / muconate lactonizing enzyme from vibrionales bacterium swat-3
PDB Compounds: (B:) mandelate racemase

SCOPe Domain Sequences for d3dfhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dfhb1 d.54.1.0 (B:4-117) automated matches {Vibrionales bacterium [TaxId: 391574]}
ketiisdihciitkpdrhnlitvvvetnegvtgfgcatfqqrplavktmvdeylkpilig
knanniedlwqmmmvnaywrngpvinnaisgvdmalwdikaklagmplhqlfgg

SCOPe Domain Coordinates for d3dfhb1:

Click to download the PDB-style file with coordinates for d3dfhb1.
(The format of our PDB-style files is described here.)

Timeline for d3dfhb1: