Lineage for d3dfha2 (3dfh A:118-380)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837891Species Vibrionales bacterium [TaxId:391574] [311278] (1 PDB entry)
  8. 2837892Domain d3dfha2: 3dfh A:118-380 [305204]
    Other proteins in same PDB: d3dfha1, d3dfha3, d3dfhb1, d3dfhb3, d3dfhc1, d3dfhc3
    automated match to d3bsma2
    complexed with na

Details for d3dfha2

PDB Entry: 3dfh (more details), 2.2 Å

PDB Description: crystal structure of putative mandelate racemase / muconate lactonizing enzyme from vibrionales bacterium swat-3
PDB Compounds: (A:) mandelate racemase

SCOPe Domain Sequences for d3dfha2:

Sequence, based on SEQRES records: (download)

>d3dfha2 c.1.11.0 (A:118-380) automated matches {Vibrionales bacterium [TaxId: 391574]}
ksrdaipvythatsdtmegiydlvegflekgykhircqlgfyggvptdlhttqnptegsy
ydqdqymdntltmfkslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilp
pnqtewldnirsqssvslglgelfnnpeewkslianrridfirchvsqiggitpalklgh
lcqnfgvriawhcppdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaeping
ylyaseiagigveidreaaaefp

Sequence, based on observed residues (ATOM records): (download)

>d3dfha2 c.1.11.0 (A:118-380) automated matches {Vibrionales bacterium [TaxId: 391574]}
ksrdaipvythatsdtmegiydlvegflekgykhircqlgfdqdqymdntltmfkslrek
ygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilppnqtewldnirsqssvslgl
gelfnnpeewkslianrridfirchvsqiggitpalklghlcqnfgvriawhcppdmtpi
gaavnthlnvhlhnaaiqehveyngnthkvfpnaaepingylyaseiagigveidreaaa
efp

SCOPe Domain Coordinates for d3dfha2:

Click to download the PDB-style file with coordinates for d3dfha2.
(The format of our PDB-style files is described here.)

Timeline for d3dfha2: