Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (79 species) not a true protein |
Species Vibrionales bacterium [TaxId:391574] [311278] (1 PDB entry) |
Domain d3dfha2: 3dfh A:118-380 [305204] Other proteins in same PDB: d3dfha1, d3dfha3, d3dfhb1, d3dfhb3, d3dfhc1, d3dfhc3 automated match to d3bsma2 complexed with na |
PDB Entry: 3dfh (more details), 2.2 Å
SCOPe Domain Sequences for d3dfha2:
Sequence, based on SEQRES records: (download)
>d3dfha2 c.1.11.0 (A:118-380) automated matches {Vibrionales bacterium [TaxId: 391574]} ksrdaipvythatsdtmegiydlvegflekgykhircqlgfyggvptdlhttqnptegsy ydqdqymdntltmfkslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilp pnqtewldnirsqssvslglgelfnnpeewkslianrridfirchvsqiggitpalklgh lcqnfgvriawhcppdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaeping ylyaseiagigveidreaaaefp
>d3dfha2 c.1.11.0 (A:118-380) automated matches {Vibrionales bacterium [TaxId: 391574]} ksrdaipvythatsdtmegiydlvegflekgykhircqlgfdqdqymdntltmfkslrek ygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilppnqtewldnirsqssvslgl gelfnnpeewkslianrridfirchvsqiggitpalklghlcqnfgvriawhcppdmtpi gaavnthlnvhlhnaaiqehveyngnthkvfpnaaepingylyaseiagigveidreaaa efp
Timeline for d3dfha2: