Lineage for d1aogb1 (1aog B:5-169,B:287-357)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 20781Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 20782Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 20948Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (9 proteins)
  6. 21089Protein Trypanothione reductase [51947] (2 species)
  7. 21119Species Trypanosoma cruzi [TaxId:5693] [51949] (3 PDB entries)
  8. 21122Domain d1aogb1: 1aog B:5-169,B:287-357 [30519]
    Other proteins in same PDB: d1aoga3, d1aogb3

Details for d1aogb1

PDB Entry: 1aog (more details), 2.3 Å

PDB Description: trypanosoma cruzi trypanothione reductase (oxidized form)

SCOP Domain Sequences for d1aogb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aogb1 c.3.1.5 (B:5-169,B:287-357) Trypanothione reductase {Trypanosoma cruzi}
ifdlvvigagsggleaawnaatlykkrvavidvqmvhgppffsalggtcvnvgcvpkklm
vtgaqymehlresagfgwefdrttlraewknliavkdeavlninksydemfrdtegleff
lgwgslesknvvnvresadpasavkerletehillasgswphmpnXgrsprtkdlqlqna
gvmiknggvqvdeysrtnvsniyaigdvtnrvmltpvaineaaalvdtvfgttprkt

SCOP Domain Coordinates for d1aogb1:

Click to download the PDB-style file with coordinates for d1aogb1.
(The format of our PDB-style files is described here.)

Timeline for d1aogb1: