Lineage for d3c7bb5 (3c7b B:123-196,B:262-366)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2977656Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily)
    beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2
  4. 2977657Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families) (S)
    duplication: contains two domains of this fold
  5. 2977658Family d.134.1.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56015] (5 proteins)
  6. 2977680Protein Dissimilatory sulfite reductase subunit beta, DsrB [160772] (2 species)
  7. 2977681Species Archaeoglobus fulgidus [TaxId:2234] [160774] (9 PDB entries)
    Uniprot Q59110 123-196,262-366
  8. 2977682Domain d3c7bb5: 3c7b B:123-196,B:262-366 [305149]
    Other proteins in same PDB: d3c7bb4, d3c7bb6, d3c7be4, d3c7be6
    automated match to d3mmcb3
    complexed with sf4, so3, srm

Details for d3c7bb5

PDB Entry: 3c7b (more details), 2 Å

PDB Description: Structure of the dissimilatory sulfite reductase from Archaeoglobus fulgidus
PDB Compounds: (B:) sulfite reductase, dissimilatory-type subunit beta

SCOPe Domain Sequences for d3c7bb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c7bb5 d.134.1.1 (B:123-196,B:262-366) Dissimilatory sulfite reductase subunit beta, DsrB {Archaeoglobus fulgidus [TaxId: 2234]}
kgeyglsnivhtqgwihchtpaidasgivkavmdelyeyftdhklpamcrislaccanmc
gavhasdiaivgihXdgaaimvggklsearrmpelskvvvpwvpnepprwptlvkyvkqi
leawaanankherliewvdrigwerffeltgleftqhliddyritpyfysefrastqfkw

SCOPe Domain Coordinates for d3c7bb5:

Click to download the PDB-style file with coordinates for d3c7bb5.
(The format of our PDB-style files is described here.)

Timeline for d3c7bb5: