Lineage for d3bc7b_ (3bc7 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002276Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 3002277Protein automated matches [190159] (21 species)
    not a true protein
  7. 3002332Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries)
  8. 3002370Domain d3bc7b_: 3bc7 B: [305088]
    automated match to d3p7gb_
    complexed with ca, man

Details for d3bc7b_

PDB Entry: 3bc7 (more details), 1.6 Å

PDB Description: The carbohydrate recognition domain of Langerin reveals high structural similarity with the one of DC-SIGN but an additional, calcium-independent sugar-binding site
PDB Compounds: (B:) C-type lectin domain family 4 member K

SCOPe Domain Sequences for d3bc7b_:

Sequence, based on SEQRES records: (download)

>d3bc7b_ d.169.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltk
agmegdwswvddtpfnkvqsvrfwipgepnnagnnehcgnikapslqawndapcdktflf
ickrpyvp

Sequence, based on observed residues (ATOM records): (download)

>d3bc7b_ d.169.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltk
agdwswvddtpfnkvqsvrfwipgepnnagnnehcgnikapslqawndapcdktflfick
rpyvp

SCOPe Domain Coordinates for d3bc7b_:

Click to download the PDB-style file with coordinates for d3bc7b_.
(The format of our PDB-style files is described here.)

Timeline for d3bc7b_: