SCOPe 2.06: Domain d3b2qa3: 3b2q A:351-457

Lineage for d3b2qa3 (3b2q A:351-457)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families)

5. Family a.69.1.0: automated matches [254233] (1 protein)
   not a true family

6. Protein automated matches [254528] (11 species)
   not a true protein

7. Species Methanosarcina mazei [TaxId:2209] [311243] (3 PDB entries)

8. Domain d3b2qa3: 3b2q A:351-457 [305050]
   Other proteins in same PDB: d3b2qa1, d3b2qa2, d3b2qb1, d3b2qb2
   automated match to d3j9tb3
   complexed with aes, atp, cit; mutant

Details for d3b2qa3

PDB Entry: 3b2q, 2.1 Å

PDB Description: intermediate position of atp on its trail to the binding pocket inside the subunit b mutant r416w of the energy converter a1ao atp synthase

PDB Compounds: (A:) V-type ATP synthase beta chain

SCOPe Domain Sequences for d3b2qa3:

Sequence; same for both SEQRES and ATOM records:

>d3b2qa3 a.69.1.0 (A:351-457) automated matches {Methanosarcina mazei [TaxId: 2209]}
mnsgigagktredhkavsdqmyagyaegrdlrglvaivgkealserdtkflefadlfedk
fvrqgwnenrtiedtleigwqilthlpenqlgridnkyiqkyhpahr

Timeline for d3b2qa3:

• d3b2qa3 is new in SCOPe 2.06-stable
  
• d3b2qa3 appears in SCOPe 2.07
  
• d3b2qa3 appears in the current release, SCOPe 2.08