Lineage for d3aysa_ (3ays A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2832985Species Piromyces rhizinflatus [TaxId:73428] [311273] (2 PDB entries)
  8. 2832987Domain d3aysa_: 3ays A: [305028]
    automated match to d4im4a_

Details for d3aysa_

PDB Entry: 3ays (more details), 2.2 Å

PDB Description: gh5 endoglucanase from a ruminal fungus in complex with cellotriose
PDB Compounds: (A:) endoglucanase

SCOPe Domain Sequences for d3aysa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aysa_ c.1.8.0 (A:) automated matches {Piromyces rhizinflatus [TaxId: 73428]}
irdisskelikemnfgwnlgntmdaqcieylnyekdqtasetcwgnpkttedmfkvlidn
qfnvfripttwsghfgeapdykidekwlkrvhevvdypykngafvilnlhhetwnhafse
tldtakeilekiwsqiaeefkdydehlifeglnaprkndtpvewtggdqegwdavnamna
vflktvrsaggnnpkrhlmippyaaacnensfnnfifpedddkviasvhayapynfalnn
gegavdkfdaagkrdlewninlmkkrfvdqgipmilgeygamnrdneedratwaefymek
vtamgvpqiwwdngvfegtgerfglldrknlkivyptivaalqkgrglevnvvhaie

SCOPe Domain Coordinates for d3aysa_:

Click to download the PDB-style file with coordinates for d3aysa_.
(The format of our PDB-style files is described here.)

Timeline for d3aysa_: