SCOPe 2.06: Domain d3asaa_: 3asa A:

Lineage for d3asaa_ (3asa A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (121 species)
   not a true protein

7. Species Chlamydia trachomatis [TaxId:813] [311270] (2 PDB entries)

8. Domain d3asaa_: 3asa A: [305019]
   automated match to d3qgua_

Details for d3asaa_

PDB Entry: 3asa, 2.05 Å

PDB Description: Crystal structure of apo-LL-diaminopimelate aminotransferase from Chlamydia trachomatis

PDB Compounds: (A:) LL-diaminopimelate aminotransferase

SCOPe Domain Sequences for d3asaa_:

Sequence; same for both SEQRES and ATOM records:

>d3asaa_ c.67.1.0 (A:) automated matches {Chlamydia trachomatis [TaxId: 813]}
mkrnphfvsltknylfadlqkrvaqfrlenpqhtvinlsigdttqplnasvaeafassia
rlsspttcrgygpdfglpalrqklsedfyrgfvdakeifisdgakvdlfrllsffgpnqt
vaiqdpsypayldiarltgakeiialpclqenaffpefpedthidilclcspnnptgtvl
nkdqlraivhyaieheililfdaaystfisdpslpksifeipdarfcaieinsfskplgf
agirlgwtvipqeltyadghfviqdwerflsttfngasipaqeagvaglsilpqleaihy
yrensdllrkallatgfevfggehapylwvkptqanisdrdlfdfflreyhiaitpgigf
grsgsgfvrfsslgkredilaacerlqm

Timeline for d3asaa_:

• d3asaa_ is new in SCOPe 2.06-stable
  
• d3asaa_ appears in SCOPe 2.07
  
• d3asaa_ appears in the current release, SCOPe 2.08