Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Thermus thermophilus [TaxId:262724] [270920] (3 PDB entries) |
Domain d3aogl2: 3aog L:188-424 [304999] Other proteins in same PDB: d3aoga1, d3aogb1, d3aogc1, d3aogd1, d3aoge1, d3aogf1, d3aogg1, d3aogh1, d3aogi1, d3aogj1, d3aogk1, d3aogl1 automated match to d4xgia2 complexed with glu, nh4, po4 |
PDB Entry: 3aog (more details), 2.1 Å
SCOPe Domain Sequences for d3aogl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3aogl2 c.2.1.0 (L:188-424) automated matches {Thermus thermophilus [TaxId: 262724]} lggslgrrdatgrgvfitaaaaaekiglqvegarvaiqgfgnvgnaaarafhdhgarvva vqdhtgtvyneagidpydllrhvqefggvrgypkaeplpaadfwglpveflvpaalekqi teqnawrirarivaegangpttpaaddillekgvlvvpdvianaggvtvsyfewvqdfns yfwteeeinarlervlrnafeavwqvaqekkiplrtaayvvaatrvlearalrglyp
Timeline for d3aogl2: