Lineage for d3aejd_ (3aej D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2148410Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2148411Protein automated matches [190151] (121 species)
    not a true protein
  7. 2148688Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [311267] (7 PDB entries)
  8. 2148716Domain d3aejd_: 3aej D: [304930]
    automated match to d3ri6a_
    complexed with aa5, gol, met, so4

Details for d3aejd_

PDB Entry: 3aej (more details), 2.59 Å

PDB Description: reaction intermediate structure of entamoeba histolytica methionine gamma-lyase 1 tetramer containing michaelis complex and methionine- pyridoxal-5'-phosphate
PDB Compounds: (D:) methionine gamma-lyase

SCOPe Domain Sequences for d3aejd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aejd_ c.67.1.0 (D:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
ditttllhpkgdhvlhshaypifqtstfcfdstqqgadlfmgkgeghiysrlgnptveqf
eemvcsiegaagsaafgsgmgaissstlaflqkgdhliagdtlygctvslfthwlprfgi
evdlidtsdvekvkaawkpntkmvylespanptckvsdikgiavvchergarlvvdatft
spcflkplelgadialhsvskyinghgdviggvssaktaediatikfyrkdagslmapmd
aflcargmktlpirmqihmenglkvakfleqhekivkvnhpglesfpghdiakkqmtgyg
stflfemksfeaakklmehlkvctlavslgcvdtliehpasmthaavpenimrkqgitpe
lvrisvgienvddiiadlkqalel

SCOPe Domain Coordinates for d3aejd_:

Click to download the PDB-style file with coordinates for d3aejd_.
(The format of our PDB-style files is described here.)

Timeline for d3aejd_: