Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (121 species) not a true protein |
Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [311267] (7 PDB entries) |
Domain d3aejd_: 3aej D: [304930] automated match to d3ri6a_ complexed with aa5, gol, met, so4 |
PDB Entry: 3aej (more details), 2.59 Å
SCOPe Domain Sequences for d3aejd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3aejd_ c.67.1.0 (D:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} ditttllhpkgdhvlhshaypifqtstfcfdstqqgadlfmgkgeghiysrlgnptveqf eemvcsiegaagsaafgsgmgaissstlaflqkgdhliagdtlygctvslfthwlprfgi evdlidtsdvekvkaawkpntkmvylespanptckvsdikgiavvchergarlvvdatft spcflkplelgadialhsvskyinghgdviggvssaktaediatikfyrkdagslmapmd aflcargmktlpirmqihmenglkvakfleqhekivkvnhpglesfpghdiakkqmtgyg stflfemksfeaakklmehlkvctlavslgcvdtliehpasmthaavpenimrkqgitpe lvrisvgienvddiiadlkqalel
Timeline for d3aejd_: