Lineage for d3a5ck4 (3a5c K:432-577)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330430Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2330431Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families) (S)
  5. 2330621Family a.69.1.2: C-terminal domain of A and B subunits of V1 ATP synthase and A1 ATP sythase [310617] (3 proteins)
  6. 2330627Protein V1 ATP synthase A subunit, C-terminal domain [310709] (2 species)
  7. 2330632Species Thermus thermophilus HB8 [TaxId:300852] [310942] (2 PDB entries)
  8. 2330640Domain d3a5ck4: 3a5c K:432-577 [304902]
    Other proteins in same PDB: d3a5ca1, d3a5ca2, d3a5ca3, d3a5cb1, d3a5cb2, d3a5cb3, d3a5cc1, d3a5cc2, d3a5cc3, d3a5cd1, d3a5cd2, d3a5cd3, d3a5ce1, d3a5ce2, d3a5ce3, d3a5cf1, d3a5cf2, d3a5cf3, d3a5cg_, d3a5ch_, d3a5ci1, d3a5ci2, d3a5ci3, d3a5cj1, d3a5cj2, d3a5cj3, d3a5ck1, d3a5ck2, d3a5ck3, d3a5cl1, d3a5cl2, d3a5cl3, d3a5cm1, d3a5cm2, d3a5cm3, d3a5cn1, d3a5cn2, d3a5cn3, d3a5co_, d3a5cp_
    complexed with adp

Details for d3a5ck4

PDB Entry: 3a5c (more details), 4.51 Å

PDB Description: Inter-subunit interaction and quaternary rearrangement defined by the central stalk of prokaryotic V1-ATPase
PDB Compounds: (K:) V-type ATP synthase alpha chain

SCOPe Domain Sequences for d3a5ck4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a5ck4 a.69.1.2 (K:432-577) V1 ATP synthase A subunit, C-terminal domain {Thermus thermophilus HB8 [TaxId: 300852]}
tsaldpwyrenvaedypelrdaisellqreaglqeivqlvgpdalqdaerlvievgriir
edflqqnayhevdaycsmkkaygimkmilafykeaeaaikrgvsideilqlpvlerigra
ryvseeefpayfeeamkeiqgafkal

SCOPe Domain Coordinates for d3a5ck4:

Click to download the PDB-style file with coordinates for d3a5ck4.
(The format of our PDB-style files is described here.)

Timeline for d3a5ck4:

View in 3D
Domains from other chains:
(mouse over for more information)
d3a5ca1, d3a5ca2, d3a5ca3, d3a5ca4, d3a5cb1, d3a5cb2, d3a5cb3, d3a5cb4, d3a5cc1, d3a5cc2, d3a5cc3, d3a5cc4, d3a5cd1, d3a5cd2, d3a5cd3, d3a5ce1, d3a5ce2, d3a5ce3, d3a5cf1, d3a5cf2, d3a5cf3, d3a5cg_, d3a5ch_, d3a5ci1, d3a5ci2, d3a5ci3, d3a5ci4, d3a5cj1, d3a5cj2, d3a5cj3, d3a5cj4, d3a5cl1, d3a5cl2, d3a5cl3, d3a5cm1, d3a5cm2, d3a5cm3, d3a5cn1, d3a5cn2, d3a5cn3, d3a5co_, d3a5cp_