SCOPe 2.08: Domain d3a5ca3: 3a5c A:113-184

Lineage for d3a5ca3 (3a5c A:113-184)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.5: V1 ATP synthase A subunit, bulge domain-like [310577] (1 family)
   PubMed 19893485

5. Family b.84.5.1: V1 ATP synthase A subunit, bulge domain-like [310616] (2 proteins)

6. Protein V1 ATP synthase A subunit, bulge domain [310706] (2 species)

7. Species Thermus thermophilus HB8 [TaxId:300852] [310935] (2 PDB entries)

8. Domain d3a5ca3: 3a5c A:113-184 [304870]
   Other proteins in same PDB: d3a5ca1, d3a5ca2, d3a5ca4, d3a5cb1, d3a5cb2, d3a5cb4, d3a5cc1, d3a5cc2, d3a5cc4, d3a5cd1, d3a5cd2, d3a5cd3, d3a5ce1, d3a5ce2, d3a5ce3, d3a5cf1, d3a5cf2, d3a5cf3, d3a5cg_, d3a5ch_, d3a5ci1, d3a5ci2, d3a5ci4, d3a5cj1, d3a5cj2, d3a5cj4, d3a5ck1, d3a5ck2, d3a5ck4, d3a5cl1, d3a5cl2, d3a5cl3, d3a5cm1, d3a5cm2, d3a5cm3, d3a5cn1, d3a5cn2, d3a5cn3, d3a5co_, d3a5cp_
   complexed with adp

Details for d3a5ca3

PDB Entry: 3a5c, 4.51 Å

PDB Description: Inter-subunit interaction and quaternary rearrangement defined by the central stalk of prokaryotic V1-ATPase

PDB Compounds: (A:) V-type ATP synthase alpha chain

SCOPe Domain Sequences for d3a5ca3:

Sequence; same for both SEQRES and ATOM records:

>d3a5ca3 b.84.5.1 (A:113-184) V1 ATP synthase A subunit, bulge domain {Thermus thermophilus HB8 [TaxId: 300852]}
rekkwawtpmvkpgdevrggmvlgtvpefgfthkilvppdvrgrvkevkpageytveepv
vvledgtelkmy

Timeline for d3a5ca3:

• d3a5ca3 first appeared in SCOPe 2.06
  
• d3a5ca3 appears in SCOPe 2.07