Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) |
Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
Protein automated matches [226864] (29 species) not a true protein |
Species Escherichia coli [TaxId:562] [234160] (2 PDB entries) |
Domain d2yfga1: 2yfg A:6-196 [304748] Other proteins in same PDB: d2yfga2, d2yfgb2, d2yfgc2, d2yfgd2, d2yfge2, d2yfgf2 automated match to d4bhta1 complexed with gol |
PDB Entry: 2yfg (more details), 2.5 Å
SCOPe Domain Sequences for d2yfga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yfga1 c.58.1.0 (A:6-196) automated matches {Escherichia coli [TaxId: 562]} slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv vwvddrnqiqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk lsnntacvftg
Timeline for d2yfga1: