Lineage for d4grt_2 (4grt 166-290)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 20781Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 20782Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 20948Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (9 proteins)
  6. 20992Protein Glutathione reductase [51944] (2 species)
  7. 21010Species Human (Homo sapiens) [TaxId:9606] [51945] (16 PDB entries)
  8. 21042Domain d4grt_2: 4grt 166-290 [30472]
    Other proteins in same PDB: d4grt_3

Details for d4grt_2

PDB Entry: 4grt (more details), 2.8 Å

PDB Description: human glutathione reductase a34e, r37w mutant, mixed disulfide between trypanothione and the enzyme

SCOP Domain Sequences for d4grt_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4grt_2 c.3.1.5 (166-290) Glutathione reductase {Human (Homo sapiens)}
sqipgaslgitsdgffqleelpgrsvivgagyiavemagilsalgsktslmirhdkvlrs
fdsmistncteelenagvevlkfsqvkevkktlsglevsmvtavpgrlpvmtmipdvdcl
lwaig

SCOP Domain Coordinates for d4grt_2:

Click to download the PDB-style file with coordinates for d4grt_2.
(The format of our PDB-style files is described here.)

Timeline for d4grt_2: