Lineage for d2xxed2 (2xxe D:165-331)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2233134Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2233135Protein automated matches [226850] (29 species)
    not a true protein
  7. 2233307Species Thermus thermophilus [TaxId:300852] [311258] (1 PDB entry)
  8. 2233311Domain d2xxed2: 2xxe D:165-331 [304679]
    Other proteins in same PDB: d2xxea1, d2xxeb1, d2xxec1, d2xxed1
    automated match to d2v7pa2
    mutant

Details for d2xxed2

PDB Entry: 2xxe (more details), 3 Å

PDB Description: single point mutant of Thermus thermophilus lactate dehydrogenase
PDB Compounds: (D:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2xxed2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xxed2 d.162.1.0 (D:165-331) automated matches {Thermus thermophilus [TaxId: 300852]}
tildtarfrallaeylrvapqsvhayvlgehgdsevlvwssaqvggvpllefaeargaal
spedraridegvrraayriiegkgatyygigaglarlvrailtdekgvytvsaftpeveg
vlevslslprilgaggvegtvypslspeerealrrsaeilkeaafalgf

SCOPe Domain Coordinates for d2xxed2:

Click to download the PDB-style file with coordinates for d2xxed2.
(The format of our PDB-style files is described here.)

Timeline for d2xxed2: