SCOPe 2.06: Domain d2xxed1: 2xxe D:22-164

Lineage for d2xxed1 (2xxe D:22-164)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [311257] (1 PDB entry)

8. Domain d2xxed1: 2xxe D:22-164 [304678]
   Other proteins in same PDB: d2xxea2, d2xxeb2, d2xxec2, d2xxed2
   automated match to d2v7pa1
   mutant

Details for d2xxed1

PDB Entry: 2xxe, 3 Å

PDB Description: single point mutant of Thermus thermophilus lactate dehydrogenase

PDB Compounds: (D:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2xxed1:

Sequence, based on SEQRES records:

>d2xxed1 c.2.1.0 (D:22-164) automated matches {Thermus thermophilus [TaxId: 300852]}
mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
vmtqvayrlsglppgrvvgsg

Sequence, based on observed residues (ATOM records):

>d2xxed1 c.2.1.0 (D:22-164) automated matches {Thermus thermophilus [TaxId: 300852]}
mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
sygdlegaravvlaagvetrlqlldrnaqvfaqvvprvleaapeavllvatnpvdvmtqv
ayrlsglppgrvvgsg

Timeline for d2xxed1:

• d2xxed1 is new in SCOPe 2.06-stable
  
• d2xxed1 appears in SCOPe 2.07
  
• d2xxed1 appears in the current release, SCOPe 2.08