Lineage for d2xxec2 (2xxe C:165-331)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2999522Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2999523Protein automated matches [226850] (47 species)
    not a true protein
  7. 2999804Species Thermus thermophilus [TaxId:300852] [311258] (1 PDB entry)
  8. 2999807Domain d2xxec2: 2xxe C:165-331 [304677]
    Other proteins in same PDB: d2xxea1, d2xxeb1, d2xxec1, d2xxed1
    automated match to d2v7pa2
    mutant

Details for d2xxec2

PDB Entry: 2xxe (more details), 3 Å

PDB Description: single point mutant of Thermus thermophilus lactate dehydrogenase
PDB Compounds: (C:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2xxec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xxec2 d.162.1.0 (C:165-331) automated matches {Thermus thermophilus [TaxId: 300852]}
tildtarfrallaeylrvapqsvhayvlgehgdsevlvwssaqvggvpllefaeargaal
spedraridegvrraayriiegkgatyygigaglarlvrailtdekgvytvsaftpeveg
vlevslslprilgaggvegtvypslspeerealrrsaeilkeaafalgf

SCOPe Domain Coordinates for d2xxec2:

Click to download the PDB-style file with coordinates for d2xxec2.
(The format of our PDB-style files is described here.)

Timeline for d2xxec2: